KALIOS.HEALTH

Written by G · Checked · 54 sources

No vendors · No affiliates · Nothing to sell

← All Compounds

Peptide — Glucagon-Like Peptide-2 (GLP-2) Analog

Teduglutide

FDA Approved

Gattex · Revestive · Teduglutide Viatris · ALX-0600 · TAK-633 · [Gly2]GLP-2 · HGDGSFSDEMNTILDNLAARDFINWLIQTKITD · a peptide of 33 amino acids

A lab-made copy of GLP-2, a hormone made in the lower gut, with one amino acid swapped so it resists the enzyme that breaks the natural hormone down within minutes; it is injected under the skin once a day (Gattex label; Jeppesen et al., 2005; Hartmann et al., 2000). Approved since 2012 for short bowel syndrome in the EU (Revestive) and the US (Gattex), where its label covers people who depend on IV nutrition or fluids (EMA, 2012; Drugs@FDA; Gattex label).

Reconstituting this? Do the math.

Holding a vial? Check its lab report →

Molecular Weight
3752 Da (C164H252N44O55S)
Sequence
33 amino acids (HGDGSFSDEMNTILDNLAARDFINWLIQTKITD)
Half-life
About 2 h in healthy volunteers, 1.3 h in short bowel syndrome (label)
Route (studied)
SubQ (people) · SubQ (mice, rats)
Route (sold)
SubQ vials (Gattex; Revestive in the EU); lab reagent powder (research only)
FDA Status
Approved 2012 (Gattex, NDA 203441) · not on FDA’s 503A or 503B lists
Pipeline
Phase 3 in Chinese adults with short bowel syndrome (open-label, 13 enrolled) (NCT06973304), primary completion est. Feb 2027; Phase 2 in undernourished women with environmental enteric dysfunction (Bangladesh) (NCT07537686), primary completion est. Oct 2027
Developer
Allelix, then NPS (merged 1999); Takeda holds the US application
Approved Elsewhere
EU 2012 (Revestive; generic 2026) · Japan 2021 · Canada 2015 · Argentina · others not checked
Published Studies
386 PubMed records (Oct 4, 2026); 322 on short bowel or intestinal failure
Human Studies
2 adult Phase 3 RCTs (83, 86) + extensions · child trials (42, 59)
WADA Status
Not prohibited (Global DRO, Oct 2026) · not named on the List; approved, so not S0
Evidence Strength
Short bowel syndrome: two placebo-controlled Phase 3s
Other uses: small randomized Phase 2 trials and a retrospective survey
Cost & Access
Prescription only · US price above $400,000 a year (2020 study)
The other four questions

What does it do? It switches on GLP-2 receptors in the gut wall; in animals that releases local growth signals such as IGF-1 and keratinocyte growth factor and raises blood flow to the gut (Gattex label; Ørskov et al., 2005; Guan et al., 2003). In an open-label pilot in 16 people with short bowel syndrome, with no placebo group, 21 days of it raised the gut’s fluid absorption by about 740 g a day over their own baseline, and in those with an end-jejunostomy it made the villi of the remaining small bowel 38% taller (Jeppesen et al., 2005).
Who uses it? People with short bowel syndrome, on prescription: in the US, adults and children from 1 year who depend on IV nutrition or fluids; in the EU, patients from 4 months of corrected age who are stable after their gut has adapted (Gattex label; Revestive EU label). It has also been tried in Crohn’s disease, HIV, child malnutrition and gut graft-versus-host disease, none of them approved uses (Buchman et al., 2010; NCT02431325; Chandwe et al., 2024; Brehm et al., 2025). Chemical suppliers list it as a lab reagent, and one supplier’s product insert marks it for research only; no research-peptide listing aimed at consumers turned up in the searches for this page (searched October 4, 2026).
Does the evidence hold up? For short bowel syndrome, yes, within limits. In a 24-week placebo-controlled trial of 86 adults, 63% on teduglutide and 30% on placebo cut weekly IV support by at least a fifth (Jeppesen et al., 2012); the earlier Phase 3 missed its main endpoint, so its better result at the lower dose counted only as hypothesis-generating (Jeppesen et al., 2011; Drucker, 2019), and quality-of-life scores did not improve significantly more than on placebo (Jeppesen et al., 2013). The two adult Phase 3s and both pediatric trials were company trials (NCT00081458; NCT00798967; NCT01952080; NCT02682381), and the long-term data come from extensions without a placebo group (O’Keefe et al., 2013; Schwartz et al., 2016).
Bottom line? An approved drug for a rare, serious condition (EMA, 2023; Drucker, 2019), with real but partial benefit: 63% of adults on it cut IV support by at least a fifth in the main trial, and 16 of 134 across the adult trials came off IV support entirely (Jeppesen et al., 2012; Iyer et al., 2017). Its label warns that it may cause tumors or speed the growth of abnormal cells already in the body, and sets a schedule of colonoscopies (Gattex label). No trial has tested it for tendon, muscle or skin repair, or for any benefit in healthy people (PubMed and ClinicalTrials.gov, searched October 4, 2026).

Dosing from the Literature

Published for short bowel syndrome: 0.05 mg/kg once a day under the skin, the label dose for adults and children from 1 year (half that with moderate or severe kidney impairment), tested against placebo in two 24-week trials in adults (Gattex label). Not published: a trial of it for tendon, muscle or skin repair, or for any benefit in healthy people.

The rows record doses as the labels and the trials give them, each with its population; they are not recommendations. Every dose was an injection under the skin, once a day unless the row says otherwise.

SourceAmountFrequencyDurationPopulationNotes
FDA label (Gattex, 2025)0.05 mg/kgOnce a day, into the abdomen, thigh or upper armNot fixed by the labelAdults and children 1 year and older with short bowel syndrome who depend on parenteral supportThe label advises against the 5 mg kit in children under 10 kg; at most 0.38 mL (3.8 mg) can be drawn from a vial.
FDA label (Gattex, 2025)0.025 mg/kgOnce a dayNot fixed by the labelAdults and children with eGFR below 60 mL/min/1.73 m², including end-stage kidney diseaseBlood exposure rose up to 2.6-fold with kidney impairment.
EU label (Revestive, 2025)0.05 mg/kgOnce a dayEffect reviewed at 6 months (at 12 weeks under age 2)Patients 4 months of corrected age and older with short bowel syndrome, stable after intestinal adaptationA 1.25 mg vial serves children up to 20 kg.
Trial dose, Phase 3 STEPS (Jeppesen et al., 2012)0.05 mg/kgOnce a day24 weeks86 adults with short bowel syndrome on parenteral support (43 on teduglutide, 43 on placebo)63% against 30% cut weekly IV support by at least a fifth.
Trial dose, Phase 3 (Jeppesen et al., 2011)0.05 or 0.10 mg/kgOnce a day24 weeks, then up to 28 more in an extension (O’Keefe et al., 2013)83 adults with short bowel syndrome on parenteral support0.10 mg/kg missed the main endpoint; the better 0.05 mg/kg result counted only as hypothesis-generating (Drucker, 2019).
Trial dose, open-label pilot (Jeppesen et al., 2005)0.03, 0.10 or 0.15 mg/kg a dayOnce or twice a day21 days16 adults with short bowel syndromeFluid absorption rose by about 740 g a day over each patient’s own baseline (no placebo group); the gains reversed after stopping.
Trial dose, children, open-label (Carter et al., 2017)0.0125, 0.025 or 0.05 mg/kgOnce a day12 weeks37 children aged 1–17 on parenteral nutrition, plus 5 on standard careMedian parenteral nutrition volume fell 41% at 0.025 mg/kg and 25% at 0.05 mg/kg.
Trial dose, children, Phase 3 (Kocoshis et al., 2020)0.025 or 0.05 mg/kgOnce a day24 weeks50 children aged 1–17, double-blind between the two doses, plus 9 on standard care69.2% on 0.05 mg/kg cut support by at least 20%, against 11.1% on standard care.
Trial dose, Crohn’s disease pilot (Buchman et al., 2010)0.05, 0.10 or 0.20 mg/kgOnce a day8 weeks100 adults with moderate-to-severe Crohn’s disease, randomized 1:1:1:1 to placebo or one of the three dosesNot an approved use.
Trial dose, HIV, Phase 2 (NCT02431325)0.05 mg/kgOnce a day6 months32 adults with HIV, 17 of them assigned to teduglutide (one withdrew before starting it and one declined to take it)Not an approved use; results posted on the registry, not published in a journal.
Trial dose, child malnutrition, Phase 2 (Chandwe et al., 2024)0.05 mg/kgOnce a day14 days26 children aged 6–59 months in hospital with severe acute malnutritionNot an approved use.
Healthy-volunteer dose (Marier et al., 2008)10 to 80 mgOnce a day8 days64 healthy volunteers in a randomized, placebo-controlled study, some on placeboA safety and blood-level study; the label calls 80 mg a day the highest dose studied.
Dosing Disclaimer

The Gattex label sets the dose by body weight, halves it with moderate or severe kidney impairment, and pairs it with colonoscopy and blood-test schedules (Gattex label). Apart from one safety and blood-level study in healthy volunteers, the trial doses above went to people with specific diseases, and no trial has tested it for a benefit in healthy people. None of this is a dosing guide. Always work with a licensed healthcare provider.

→ Peptide Calculator — vial-to-syringe math

What It Is

Teduglutide is a peptide of 33 amino acids: the human gut hormone glucagon-like peptide-2 (GLP-2), with glycine in place of alanine at position 2 (Gattex label; Jeppesen et al., 2005). GLP-2 is cut from a larger precursor, proglucagon; in UniProt’s numbering of the 180-amino-acid precursor, which counts its 20-amino-acid signal peptide, GLP-2 is residues 146–178 (UniProt P01275). Its formula is C164H252N44O55S and its molecular weight 3752 Da (Gattex label; PubChem). It is made in E. coli by recombinant DNA technology and sold as a freeze-dried powder for injection under the skin (Gattex label). GLP-2 is made by L-cells in the lower intestine, and it comes from the same gene, proglucagon, as GLP-1, whose receptor agonists are used for type 2 diabetes and obesity (Gattex label; Drucker, 2019). Its development codes include ALX-0600 and TAK-633 (Jeppesen et al., 2005; NCT06973304).

In 1996 Daniel Drucker’s group in Toronto reported that mice carrying proglucagon-making tumors grew extra small-bowel lining; it traced the effect to GLP-2, which enlarged the jejunum and ileum within 4 days of being given to mice (Drucker et al., 1996). The natural hormone does not last: in healthy volunteers, intact GLP-2 had a half-life of 7.2 minutes in the blood, broken down, the authors conclude, by the enzyme DPP-4 (Hartmann et al., 2000). In rats the group showed that DPP-4 limits GLP-2’s effect and that swapping the alanine at position 2 for glycine made a rat version resistant to it (Drucker, Shi et al., 1997). With Allelix Biopharmaceuticals, a Canadian company that funded the work, the group then chose the human version, [hGly2]-GLP-2, later named teduglutide; Allelix merged with NPS Pharmaceuticals in 1999, and NPS took over its development (Drucker, 2019).

The first Phase 3, in 83 adults with short bowel syndrome on IV support, missed its main endpoint at its higher dose, 0.10 mg/kg a day, the dose its statistical plan tested first, so its positive result at 0.05 mg/kg was treated as hypothesis-generating, and regulators asked for a second Phase 3 (Drucker, 2019; Jeppesen et al., 2011). That trial, STEPS, met its endpoint (Jeppesen et al., 2012). The EU authorised teduglutide as Revestive on August 30, 2012 (EMA, 2012). FDA approved Gattex on December 21, 2012 for adults with short bowel syndrome who depend on parenteral support, with a risk-management program (REMS) and a required registry study of colorectal cancer risk (FDA approval letter, 2012); its advisory committee had voted unanimously in favor on October 16, 2012 (Drucker, 2019). FDA extended the US label to children 1 year and older on May 16, 2019 (FDA approval letter, 2019); the EU label covers patients from 4 months of corrected gestational age (Revestive EU label), and Japan approved it in 2021 (Wada et al., 2026). FDA’s letters went to NPS Pharmaceuticals in 2012, to Shire-NPS Pharmaceuticals in 2018 and 2019 and to Takeda in 2025 and 2026, and Drugs@FDA lists Takeda as the sponsor (Drugs@FDA). On August 26, 2026, FDA ended the REMS as no longer necessary (FDA letter, 2026). In the EU a generic, Teduglutide Viatris, was authorised on January 8, 2026 (EMA, 2026).

PubMed returns 386 records for “teduglutide” (October 4, 2026), 322 of which mention short bowel syndrome or intestinal failure, and ClinicalTrials.gov lists 50 studies (searched October 4, 2026).

Mechanism of Action

Most of the work on how GLP-2 acts used the natural hormone in cells, rodents and pigs (Munroe et al., 1999; Ørskov et al., 2005; Guan et al., 2003). Teduglutide’s own data in people are absorption studies, gut biopsies and transit tests (Jeppesen et al., 2005; Berg et al., 2014; Iturrino et al., 2016).

  • The GLP-2 receptor — A G protein-coupled receptor, cloned in 1999; cells carrying it responded to GLP-2 but not to GLP-1 (Munroe et al., 1999). The Gattex label places it on enteroendocrine cells, subepithelial myofibroblasts and enteric nerve cells of the gut wall, and says its activation releases IGF-1, nitric oxide and keratinocyte growth factor (KGF) locally (Gattex label).
  • Resistance to DPP-4 — In healthy volunteers, intact GLP-2 had a half-life of 7.2 minutes; GLP-2(3-33), the hormone minus its first two amino acids, was the only breakdown product found, and a DPP-4 inhibitor stopped the breakdown in blood samples, so the authors attribute it to DPP-4 (Hartmann et al., 2000). The glycine at position 2 blocked the cut in the group’s rat version of the peptide (Drucker, Shi et al., 1997). Teduglutide’s half-life is about 2 hours in healthy volunteers and 1.3 hours in short bowel syndrome; 88% of a dose under the skin reaches the blood, peaking 3–5 hours later, and it is cleared mainly by the kidneys (Gattex label).
  • KGF from the cells under the lining — In rat, mouse, marmoset and human intestine, GLP-2 receptors sat mainly on subepithelial myofibroblasts that also make KGF; in mice, an antibody against KGF abolished GLP-2’s growth effect in the colon but not in the small intestine (Ørskov et al., 2005).
  • Blood flow and nitric oxide — In young pigs fed by vein for a week, GLP-2 infused into a vein raised gut blood flow by 25% and gut glucose uptake by 90%; blocking nitric oxide synthesis with L-NAME prevented both rises (Guan et al., 2003).
  • Mucosal growth in people — In patients with an end-jejunostomy, 21 days of teduglutide raised villus height by 38%, crypt depth by 22% and the mitotic index by 115%; crypt depth and mitotic index did not change in colon biopsies (Jeppesen et al., 2005). In a 24-week Phase 3, villus height and plasma citrulline rose against placebo (Jeppesen et al., 2011); the STEPS investigators describe citrulline as a marker of gut-lining mass (Jeppesen et al., 2012).
  • Gut transit: mixed findings — Natural GLP-2, 400 µg twice a day for 35 days, slowed stomach emptying of solids by 30 minutes in 8 patients without a terminal ileum or colon (Jeppesen et al., 2001). In a placebo-controlled trial of 36 healthy volunteers, the 23 given teduglutide 4 mg a day for 10 days showed no difference from placebo in stomach emptying of liquids (Berg et al., 2014); in 8 patients with short bowel syndrome, a week of it did not change stomach emptying, and overall transit was slower than on placebo but not significantly (P = 0.075) (Iturrino et al., 2016). The EU summary lists slower passage of food among the ways it works (EMA, 2023).

What the Research Shows

The results below are from animals. Most come from the Toronto group that discovered GLP-2’s effect on the gut (Drucker et al., 1996) or from a University of Copenhagen group that includes Jens Juul Holst (Thulesen et al., 2004; Ørskov et al., 2005). The human trials are in the next section.

  • Gut growth in mice — Given under the skin to mice, h[Gly2]GLP-2, teduglutide’s sequence, increased small- and large-bowel mass more than EGF, LR3 IGF-I, [Gly1]IGF-II or human growth hormone at the doses tested (Drucker, DeForest et al., 1997).
  • Colitis in mice — In mice with colitis induced by dextran sulfate, h[Gly2]GLP-2 reversed weight loss, lowered interleukin-1 and increased colon length, crypt depth and mucosal area (Drucker et al., 1999).
  • Chemotherapy injury in mice — After irinotecan or 5-fluorouracil, h[Gly2]-GLP-2 improved survival, reduced bacteria in the blood, lessened injury to the gut lining and cut cell death in the crypts; in tumor-bearing mice on irinotecan it did not weaken the chemotherapy (Boushey et al., 2001).
  • Newborn piglets after bowel resection — In 72 piglets with 80% of the small bowel removed, teduglutide at 0.1 mg/kg a day increased villus height and the gut’s capacity to process glucose and glutamine, and the effect was larger when 20% of feeding went into the gut instead of a vein (Naberhuis et al., 2017).
  • Tumors in mice and rats — In 210 mice given a colon carcinogen, a Gly2 GLP-2 analog injected twice a day after the tumors had formed significantly increased tumor load; natural GLP-2 had a smaller effect (Thulesen et al., 2004). In the label’s two-year studies, teduglutide raised bile-duct and jejunal adenomas in male rats and gallbladder papillary adenomas in mice, and caused jejunal adenocarcinomas in male mice at the highest dose, about 244 times the human exposure (Gattex label).
Research Limitations — The Discoverers’ Labs and Animal Models

The early animal work comes mostly from the Toronto lab that discovered GLP-2’s effect on the gut, funded at first by the company that developed teduglutide, and GLP-2 is the subject of a patent license between Takeda and the University of Toronto, Toronto General Hospital (University Health Network) and Daniel Drucker (Drucker, 2019). The injury models (colitis, chemotherapy) have not led to an approval for those uses in people (Gattex label; Revestive EU label). On tumors, Drucker wrote in 2019 that the preclinical data on tumor growth in the rodent gut were conflicting: teduglutide enhanced tumor growth in some but not all genetically or chemically sensitized rodent models, while the formal two-year studies in two species showed no evidence that it caused tumors (Drucker, 2019). On those two-year studies the current label differs: it reports more adenomas in male rats and jejunal adenocarcinomas in male mice at the top dose, and bases its warning on those findings and on how the drug acts (Gattex label).

Human Data

Published: a 21-day open-label pilot, two 24-week placebo-controlled Phase 3 trials in adults with their extensions, pediatric trials of 12 and 24 weeks, and small trials in other diseases. ClinicalTrials.gov lists 50 studies of teduglutide; two trials that give it to people are active or not yet recruiting (searched October 4, 2026).

  • Open-label pilot, 16 patients, 21 days (Jeppesen et al., 2005) — Adults with short bowel syndrome took 0.03, 0.10 or 0.15 mg/kg a day under the skin, once or twice a day, with no placebo group. Pooled and compared with each patient’s own baseline, absorption of fluid (wet weight) rose by 743 g a day and energy lost in stool fell by 808 kJ (193 kcal) a day; the gains had reversed after three weeks off the drug. The most common side effects were an enlarged stoma nipple and mild swelling of the lower legs.
  • Phase 3, 83 adults, 24 weeks (Jeppesen et al., 2011) — Adults who had depended on IV support for at least 12 months took 0.10 mg/kg (32), 0.05 mg/kg (35) or placebo (16) once a day. The main endpoint, a graded response score, was not met at 0.10 mg/kg (8 of 32 against 1 of 16, P = 0.16); because the plan tested 0.10 mg/kg first, the better result at 0.05 mg/kg (16 of 35, P = 0.007) counted only as hypothesis-generating (Jeppesen et al., 2011; Drucker, 2019). At week 24 both doses had cut IV volume by about 350 mL a day, against about 130 mL a day on placebo (P = 0.08), and three patients came off IV support. By the label’s responder measure, 46% on 0.05 mg/kg and 6% on placebo cut IV support by at least 20% (Gattex label).
  • Extension to 52 weeks (O’Keefe et al., 2013) — In a 28-week double-blind extension without a placebo group, 52 patients took the same doses for 52 weeks in all; at week 52, 68% on 0.05 mg/kg and 52% on 0.10 mg/kg had cut IV support by at least 20%, and four came off it. Headache (35%), nausea (31%) and abdominal pain (25%) were the most common adverse events, and seven patients withdrew because of adverse events.
  • STEPS, 86 adults, 24 weeks (Jeppesen et al., 2012) — Adults with intestinal failure took 0.05 mg/kg or placebo once a day (43 each); IV support was cut whenever 48-hour urine volume rose 10% or more above baseline. 27 of 43 on teduglutide (63%) and 13 of 43 on placebo (30%) cut weekly IV support by at least a fifth at weeks 20 and 24 (P = 0.002). Weekly IV volume fell by 4.4 L on teduglutide and 2.3 L on placebo, from about 13 L, and 54% against 23% dropped at least one infusion day a week. Quality-of-life scores improved from baseline but not significantly more than on placebo (Jeppesen et al., 2013).
  • STEPS-2, up to 30 months (Schwartz et al., 2016) — In the 2-year open-label extension, 65 of 88 patients (74%) finished. Of the 30 treated for 30 months in all, 28 (93%) had cut IV support by at least 20%, and the 30 cut it by 7.6 L a week on average (66%); 13 patients across the study came off IV support entirely (Schwartz et al., 2016; Gattex label). The most common adverse events were abdominal pain (34%), catheter sepsis (28%) and weight loss (25%).
  • Coming off IV support (Iyer et al., 2017) — Pooling five trials, 16 of 134 adults on 0.05 mg/kg reached full independence from IV support, after a median of 5 years on it and 89 weeks of teduglutide.
  • Pooled response over time (Bioletto et al., 2022) — A meta-analysis of 10 studies, two placebo-controlled trials and eight observational studies, put the share of adults cutting IV support by at least 20% at 64% at 6 months, 77% at 1 year and 82% at 2 years or more, and the share weaned off at 11%, 17% and 21%. Patients whose colon was still connected responded less often but were weaned more often.
  • Children (Carter et al., 2017; Kocoshis et al., 2020) — In a 12-week open-label trial of 42 children aged 1–17, parenteral nutrition volume fell by a median 41% on 0.025 mg/kg and 25% on 0.05 mg/kg, against 0% on standard care, and four children came off it (Carter et al., 2017). In a 24-week Phase 3 of 59 children, in which patients chose teduglutide or standard care, 69.2% of 26 on 0.05 mg/kg and 54.2% of 24 on 0.025 mg/kg cut IV support by at least 20%, against 11.1% of 9 on standard care, and three on 0.05 mg/kg came off it (Kocoshis et al., 2020; Gattex label). In the extension, 13 of the 15 earlier responders needed teduglutide again after it was stopped (Gattex label).
  • Infants (EMA, 2023) — In a study of infants aged 4–12 months of corrected age, 3 of 5 on teduglutide and 1 of 5 on standard care cut parenteral nutrition by at least a fifth at 24 weeks.
  • Other uses, none approved — In a placebo-controlled, dose-ranging pilot of 100 adults with moderate-to-severe Crohn’s disease, randomized 1:1:1:1 to placebo or 0.05, 0.10 or 0.20 mg/kg a day for 8 weeks, response and remission rates were numerically higher in every teduglutide group than on placebo, highest at 0.20 mg/kg (44% response and 32% remission, against 32% and 20%); 71 completed (Buchman et al., 2010; NCT00072839). In a placebo-controlled Phase 2 trial in 32 adults with HIV, 17 of them assigned to 0.05 mg/kg a day for 6 months (one withdrew before starting it and one declined to take it), teduglutide raised plasma citrulline against placebo (P = 0.04) and lowered a PET measure of carotid-artery inflammation (P = 0.01, in 5 against 10 patients analysed), with no significant difference in soluble CD14, a marker of monocyte activation (NCT02431325). Of the 17 assigned to teduglutide, 9 finished, against 12 of 15 on placebo; 3 on teduglutide and none on placebo left because of adverse events, no serious adverse events or deaths were reported in either group, and the results are posted on the registry, not published in a journal (NCT02431325). In a five-arm trial of 125 children in hospital with complicated severe malnutrition in Zambia and Zimbabwe, the 26 given 0.05 mg/kg a day for 14 days had a lower combined score of stool markers of gut damage than children given standard care alone (P = 0.07, against a pre-set threshold of P < 0.10; the treatments were not blinded), and no adverse event was judged related to any study treatment, including the death from tuberculosis of one child on teduglutide (Chandwe et al., 2024). In a retrospective survey of 17 patients with steroid-refractory gut graft-versus-host disease given it as salvage therapy, 11 responded (Brehm et al., 2025).
  • Use in practice, Japan (Wada et al., 2026) — In a company-run surveillance of 123 patients aged 2–83, after 6 months 11.9% (12 of 101 assessed) had come off IV support and 42.4% (39 of 92) had cut it by at least 20%.

The evidence meter on the Teduglutide card reads “Approved drug” because Gattex is FDA-approved for short bowel syndrome, a gut use (Gattex label). The approval covers people whose short bowel leaves them dependent on IV nutrition or fluids; the trials in other diseases above are small, and short bowel syndrome is the label’s only indication (Gattex label).

Reconstitution & Storage

Gattex comes as a 5 mg vial of white freeze-dried powder, with 0.5 mL of sterile water for injection in a prefilled syringe, a separate needle for mixing and a 1 mL dosing syringe with a 27-gauge needle (Gattex label). The label has each vial mixed with its 0.5 mL of water, giving 10 mg/mL; at most 0.38 mL, holding 3.8 mg, can be drawn from a vial, and the label allows 3 hours from mixing to injection and says to discard what is left (Gattex label). Its instructions are written for patients and caregivers trained by a healthcare provider; this page does not repeat them.

  • Storage (label) — The label has kits kept at 2–8 °C before dispensing and at room temperature up to 25 °C after it, with a 90-day use-by date, and says not to freeze them (Gattex label).
  • What is in the vial (label) — 5 mg of teduglutide with L-histidine, mannitol and two sodium phosphates, and no preservative (Gattex label). The EU also has a 1.25 mg vial for small children, at 2.5 mg/mL once mixed (Revestive EU label).
  • Lab-reagent powder — One chemical supplier’s product insert describes teduglutide as a solid of at least 98% purity, stored at −20 °C and labelled “for research only — not for human or veterinary diagnostic or therapeutic use” (a supplier’s product insert, read October 4, 2026). No study has tested such a product in people.

→ Peptide Calculator — vial-to-syringe math

Side Effects & Risks

The Label’s Main Warning

Gattex’s label warns of accelerated neoplastic growth: based on how the drug acts and on tumors in rats and mice, it has the potential to cause abnormal growth, tumors included, and its Medication Guide says it can make abnormal cells already in the body grow faster; polyps of the colon, stomach and small intestine have been reported. The label lists colonoscopy and upper endoscopy before adults start and after their first year, then at least every 5 years, and stopping the drug if a gut cancer is found (Gattex label). When it approved the drug, FDA required a long-term registry study with colorectal cancer as its primary outcome (FDA approval letter, 2012); the company’s registry, TED-R13-002, has 1,806 patients enrolled and its primary completion estimated for June 2032 (NCT01990040).

  • Common in the adult trials — In the two placebo-controlled trials (77 on teduglutide, 59 on placebo), abdominal pain occurred in 30% against 22%, nausea in 23% against 20%, upper respiratory infections in 21% against 12%, abdominal swelling in 20% against 2%, injection-site reactions in 13% against 12%, vomiting in 12% against 10%, fluid overload in 12% against 7%, and allergic-type skin reactions in 10% against 7% (Gattex label). The EU label puts injection-site reactions at 26% against 5% (Revestive EU label).
  • Stoma problems — Among 53 patients with a stoma, 42% (13 of 31) on teduglutide and 14% (3 of 22) on placebo had stoma complications (Gattex label).
  • Polyps and cancers — In the adult trials, 14 patients were diagnosed with gut polyps after starting study treatment: one on placebo and one on teduglutide in the controlled trials, and 12 in the extension studies, including colorectal villous, tubular and serrated adenomas; three men in an extension developed cancers, a metastatic adenocarcinoma of unconfirmed origin in a man with earlier abdominal radiation and two lung cancers in heavy smokers (Gattex label). In the STEPS series, colon polyps were found in 12% of patients before treatment and 18% after 24–36 months; of the seven examined under the microscope, five were adenomas and none was malignant (Armstrong et al., 2020). A 2021 case report describes new adenomas in the duodenum and jejunum after 41 months of treatment (Pevny et al., 2021). A 2015 case report describes metastatic alveolar rhabdomyosarcoma, a sarcoma, diagnosed in the nasopharynx about three months after a 69-year-old woman started teduglutide; its authors judged a causal role unlikely, given the short interval, but suggest the drug may have sped the cancer’s growth, and the cancer regressed completely after teduglutide was stopped and chemotherapy given (Zyczynski et al., 2015).
  • Bowel blockage — Intestinal obstruction or narrowing occurred in 3 of 77 patients on 0.05 mg/kg and 3 of 32 on 0.10 mg/kg in the controlled trials, none on placebo, and in 6 more patients in the extensions; of the 8 with an episode in the extensions, 2 needed endoscopic widening and 1 surgery (Gattex label).
  • Gallbladder and pancreas — In the controlled trials, three patients on 0.05 mg/kg, all with earlier gallbladder disease, developed cholecystitis, against none on placebo; one gallbladder perforated. A pancreatic pseudocyst and, in the extensions, acute and chronic pancreatitis were also reported (Gattex label).
  • Fluid overload and heart failure — Swelling of the legs occurred in 10% on teduglutide and 3% on placebo, and two patients on it developed congestive heart failure; the label links fluid overload to the drug’s increase in fluid absorption (Gattex label).
  • More of other drugs absorbed — One patient taking the sedative prazepam slipped into a coma in the first week of teduglutide, with a prazepam level above 300 µg/L, and recovered after both were stopped; the label flags oral drugs dosed by titration or with a narrow therapeutic index (Gattex label).
  • Antibodies — Antibodies against teduglutide appeared in 17% of adults at 6 months and 48% at 30 months, and in 54% of children at 12 months, with no link to safety problems or lost effect (Gattex label).
  • Children — In 89 children treated for a median of 52 weeks, the most common adverse events were vomiting (51.7%), fever (43.8%) and upper respiratory infections (41.6%); three serious events judged related, an ileus, D-lactic acidosis and a blockage from hard stools, all resolved, and one cecal polyp and no neoplasia were found (Hill et al., 2021).
  • Stopping it — The label warns that stopping can upset fluid and electrolyte balance (Gattex label); in the 2005 pilot, the absorption gains had reversed three weeks after the last dose (Jeppesen et al., 2005).
  • Where the labels differ — The US label lists no contraindications. The EU label rules it out in active or suspected cancer, after a cancer of the gut, liver, bile ducts or pancreas in the past five years, and in allergy to the drug or to trace residues of tetracycline (Gattex label; Revestive EU label).
  • Pregnancy and breastfeeding — Case reports have not identified a drug-related risk in pregnancy, and the label advises against breastfeeding during treatment, citing the tumors seen in animals (Gattex label).
  • WADA — Not prohibited: Global DRO, the medicine lookup run by UK Anti-Doping, the US Anti-Doping Agency, Sport Integrity Canada and Swiss Sport Integrity, lists teduglutide, and Revestive in the UK, as not prohibited in or out of competition, with no WADA classification (Global DRO, searched October 5, 2026). Teduglutide is not named on the 2026 Prohibited List. Its S0 section covers substances not addressed elsewhere on the List “with no current approval by any governmental regulatory health authority for human therapeutic use”; teduglutide is approved in the US and the EU, so S0 does not apply (World Anti-Doping Agency, 2026). Section S2.3 prohibits “other growth factors or growth factor modulators affecting muscle, tendon or ligament protein synthesis/degradation, vascularisation, energy utilization, regenerative capacity or fibre type switching”, and the Gattex label says teduglutide releases IGF-1 and keratinocyte growth factor in the gut wall; Global DRO does not place it in that class (World Anti-Doping Agency, 2026; Gattex label; Global DRO, searched October 5, 2026).

Bloodwork & Monitoring

For an approved drug, the label sets the checks. What the Gattex label lists, and what the trials measured:

  • Before starting (label) — Adults: colonoscopy and upper endoscopy, with polyps removed, within 6 months before the first dose. Children: a fecal occult blood test, with colonoscopy or sigmoidoscopy and upper endoscopy if there is new or unexplained blood. Everyone: bilirubin, alkaline phosphatase, lipase and amylase (Gattex label).
  • During treatment (label) — Adults: colonoscopy and upper endoscopy (or other imaging) at the end of the first year, then at least every 5 years. Children: a fecal occult blood test every year, and colonoscopy or sigmoidoscopy after a year and every 5 years after that. Everyone: the same four blood tests every 6 months (Gattex label). For adults, the EU label lists a colonoscopy at the start, yearly colonoscopies (or other imaging) for the first 2 years, then at least every 5 years; for children, a fecal occult blood test before starting and every year, and colonoscopy or sigmoidoscopy after a year and every 5 years after that (Revestive EU label).
  • When it is stopped (label) — Fluid and electrolyte status (Gattex label).
  • Other medicines (label) — Side effects of oral drugs that are dosed by titration or have a narrow therapeutic index (Gattex label).
  • What the trials tracked — 48-hour urine volumes, which set when IV support was cut, and plasma citrulline as a marker of gut-lining mass (Jeppesen et al., 2012); gut biopsies, in which no dysplasia was seen after 6 months in 77 patients (Tappenden et al., 2013).
  • Which tests fit a given person — A question for a licensed healthcare provider. This page can’t answer it.

Commonly Stacked With

Teduglutide was given on top of parenteral support in its adult and pediatric Phase 3 trials (Gattex label; Jeppesen et al., 2011; Jeppesen et al., 2012; Kocoshis et al., 2020); the 21-day pilot held parenteral supplements constant and included three patients who needed none (Jeppesen et al., 2005). One mouse study tested it with other compounds on this site; no human study has tested it with another compound on this site (PubMed and Europe PMC, searched October 4, 2026).

Parenteral support (in the Phase 3 trials)

The adult Phase 3 trials gave teduglutide on top of IV nutrition or fluids and cut that support as absorption improved: by protocol, whenever 48-hour urine volume rose 10% or more above baseline, at 4-week intervals in the first trial (Jeppesen et al., 2011; Jeppesen et al., 2012). The pediatric Phase 3 trials gave it to children who needed IV nutrition and measured how far their IV support fell (Carter et al., 2017; Kocoshis et al., 2020). In newborn piglets, moving 20% of feeding from the vein into the gut enhanced its effect (Naberhuis et al., 2017).

HGH and IGF-1 LR3 (mice only)

In mice, h[Gly2]GLP-2, teduglutide’s sequence, given under the skin with human growth hormone or with LR3 IGF-I increased histological measures of small-intestinal growth more than h[Gly2]GLP-2 alone, and all five growth factors tested, EGF included, given together increased bowel length and weight (Drucker, DeForest et al., 1997). No human study has tested teduglutide with either (PubMed, searched October 4, 2026).

→ Peptide Calculator — vial-to-syringe math

Legal Status

Current Status — October 2026

FDA-approved, prescription only. Gattex (teduglutide) for injection, 5 mg, NDA 203441, sponsor Takeda Pharmaceuticals USA, marketing status prescription (Drugs@FDA, read October 4, 2026). FDA approved it on December 21, 2012 for adults with short bowel syndrome who depend on parenteral support (FDA approval letter, 2012), and on May 16, 2019 for children 1 year and older (FDA approval letter, 2019). Its REMS, in place since approval, was eliminated on August 26, 2026; FDA cited data from the company’s registry (TED-R13-002), a small, stable patient and prescriber population, about 80% of 2020–2024 prescriptions written by specialists, and published clinical guidance (FDA letter, 2026). That registry, with colorectal cancer as its primary outcome, is active and no longer recruiting (NCT01990040).

Teduglutide is not on the 503A bulks list (21 CFR 216.23), on the list of drugs withdrawn or removed from the market for reasons of safety or effectiveness (21 CFR 216.24), on FDA’s 503A categories list (updated May 14, 2026) or on its 503B categories list (updated March 21, 2025). The 503A bulks list covers only substances with no USP monograph that are not a component of an FDA-approved drug (21 CFR 216.23; 21 U.S.C. 353a(b)(1)). Section 503A of the FD&C Act lets a licensed pharmacist compound with a bulk substance that meets a USP monograph or, where none exists, is a component of an FDA-approved drug, as teduglutide is (Gattex), among the section’s other conditions; it bars compounding drug products that are essentially copies of a commercially available drug product regularly or in inordinate amounts (21 U.S.C. 353a(b)(1)). No document read for this page shows it being compounded, and no FDA warning letter or import alert naming it turned up in the searches for this page (October 4 and 5, 2026).

Elsewhere, in the records read for this page (other countries were not checked): authorised in the EU as Revestive since August 30, 2012, held by Takeda Pharmaceuticals International AG Ireland Branch, for patients from 4 months of corrected gestational age, and as the generic Teduglutide Viatris since January 8, 2026 (EMA, 2012; Revestive EU label; EMA, 2026). Approved in Japan since 2021 (Wada et al., 2026). In Canada, Health Canada authorised Revestive on September 4, 2015 for adults with short bowel syndrome who depend on parenteral support, and on August 13, 2019 for children 1 year and older; Takeda Canada holds it, and it has been on the market there since October 28, 2015 (Health Canada, 2015). In Argentina, Takeda ran a post-authorization study of Revestive in adults and children treated in routine care (NCT04877431).

WADA does not name teduglutide on its 2026 Prohibited List, and as an approved drug it falls outside S0; Global DRO, the anti-doping agencies’ medicine lookup, lists it as not prohibited in or out of competition (Prohibited List 2026; Global DRO, searched October 5, 2026; see Side Effects & Risks).

Registered on ClinicalTrials.gov: an open-label Phase 3 in Chinese adults (active, not recruiting, 13 enrolled; NCT06973304), a Phase 2 in undernourished women with environmental enteric dysfunction in Bangladesh (not yet recruiting; NCT07537686), an observational study in Chinese children (NCT07319832) and the long-term registry (NCT01990040) (searched October 4, 2026).

Cost & Access

In the US, teduglutide is sold as Gattex, a prescription kit of 5 mg vials with prefilled diluent syringes, in one-vial and 30-vial kits (Gattex label). A 2020 cost analysis put its US price above $400,000 a year and found that it would need to cost more than 65% less to meet a common cost-effectiveness threshold (Raghu et al., 2020). In the EU it is sold as Revestive; a generic, Teduglutide Viatris, was authorised on January 8, 2026 (EMA, 2026). Chemical suppliers list teduglutide powder as a lab reagent (web searches, October 4, 2026), and one supplier’s product insert labels it for research only (read October 4, 2026); no consumer research-peptide listing turned up in the searches for this page, and no study has tested a reagent product in people.

Pricing and availability vary and are set by the seller. Kalios does not sell compounds.

References

  1. Takeda Pharmaceuticals America, Inc. GATTEX (teduglutide) for injection, for subcutaneous use. Prescribing information, Medication Guide and Instructions for Use (revised 09/2025; initial U.S. approval 2012). DailyMed set ID 66b69c1e-b25c-44d3-b5ff-1c1de9a516fa, version 20, effective September 5, 2025. dailymed.nlm.nih.gov. Read October 4, 2026.
  2. U.S. Food and Drug Administration. Drugs@FDA: NDA 203441, GATTEX KIT (teduglutide 5 mg/vial, powder, subcutaneous), sponsor Takeda Pharms USA, marketing status prescription; original approval December 21, 2012 (type 1, new molecular entity; orphan); efficacy supplements approved June 26, 2014, December 18, 2018 and May 16, 2019; labeling supplements to September 5, 2025 (S-24); REMS modifications to August 26, 2026 (S-28). accessdata.fda.gov/scripts/cder/daf/ (NDA 203441). Read October 5, 2026. The openFDA copy (api.fda.gov/drug/drugsfda.json, read October 4, 2026) lists the submissions to S-24 only.
  3. U.S. Food and Drug Administration. Letters for NDA 203441: approval letter (replacement), effective December 21, 2012, to NPS Pharmaceuticals, Inc., for adults with short bowel syndrome dependent on parenteral support, with a REMS and a required long-term registry study with colorectal cancer as its primary outcome (postmarketing requirement 1978-1); supplement S-012 approval, December 18, 2018, and S-013 approval, May 16, 2019, to Shire-NPS Pharmaceuticals, Inc., the latter extending the indication to pediatric patients 1 year of age and older; S-023 REMS modification, August 13, 2025, and S-28 approval, August 26, 2026, to Takeda Pharmaceuticals U.S.A., Inc., the latter eliminating the REMS. accessdata.fda.gov/drugsatfda_docs/appletter/. Read October 4, 2026.
  4. European Medicines Agency (EMA). Revestive (teduglutide): European public assessment report. Overview (last updated May 2023); marketing authorisation issued 30 August 2012, holder Takeda Pharmaceuticals International AG Ireland Branch; product information (summaries of product characteristics for the 1.25 mg and 5 mg vials, updated May 23, 2025). ema.europa.eu/en/medicines/human/EPAR/revestive. Read October 4, 2026.
  5. European Medicines Agency (EMA). Teduglutide Viatris: European public assessment report. Generic medicine of Revestive; opinion adopted 13 November 2025; marketing authorisation issued 8 January 2026, holder Viatris Limited. ema.europa.eu/en/medicines/human/EPAR/teduglutide-viatris. Read October 4, 2026.
  6. Health Canada. Summary Basis of Decision (SBD) for Revestive (teduglutide, 5 mg, powder for solution, subcutaneous; DIN 02445727), issued November 9, 2015: Notice of Compliance issued to NPS Pharma Holdings Limited on September 4, 2015, for adult patients with short bowel syndrome who are dependent on parenteral support; its post-authorization activity table lists the indication for pediatric patients 1 year of age and above (Notice of Compliance, August 13, 2019), the transfer to Takeda Canada Inc. (2020) and the date of first sale, October 28, 2015. dhpp.hpfb-dgpsa.ca/review-documents/resource/SBD00267. Drug Product Database: REVESTIVE, DIN 02445727, Takeda Canada Inc., status marketed. health-products.canada.ca. Read October 5, 2026.
  7. National Library of Medicine. PubChem: Teduglutide, CID 16139605 (C164H252N44O55S, 3752.1 g/mol; synonyms include Gattex, Revestive, ALX-0600 and [Gly2]GLP-2). pubchem.ncbi.nlm.nih.gov. Read October 4, 2026.
  8. UniProt Consortium. UniProtKB P01275 (GLUC_HUMAN), Pro-glucagon, 180 amino acids, signal peptide at residues 1–20: glucagon-like peptide 2 at residues 146–178, HADGSFSDEMNTILDNLAARDFINWLIQTKITD. rest.uniprot.org. Read October 4, 2026.
  9. Drucker DJ, Erlich P, Asa SL, Brubaker PL. Induction of intestinal epithelial proliferation by glucagon-like peptide 2. Proc Natl Acad Sci U S A. 1996;93(15):7911-7916. PMID: 8755576. DOI: 10.1073/pnas.93.15.7911.
  10. Drucker DJ, Shi Q, Crivici A, Sumner-Smith M, et al. Regulation of the biological activity of glucagon-like peptide 2 in vivo by dipeptidyl peptidase IV. Nat Biotechnol. 1997;15(7):673-677. PMID: 9219272. DOI: 10.1038/nbt0797-673.
  11. Drucker DJ, DeForest L, Brubaker PL. Intestinal response to growth factors administered alone or in combination with human [Gly2]glucagon-like peptide 2. Am J Physiol. 1997;273(6):G1252-G1262. PMID: 9435550. DOI: 10.1152/ajpgi.1997.273.6.G1252.
  12. Munroe DG, Gupta AK, Kooshesh F, Vyas TB, et al. Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2. Proc Natl Acad Sci U S A. 1999;96(4):1569-1573. PMID: 9990065. DOI: 10.1073/pnas.96.4.1569.
  13. Hartmann B, Harr MB, Jeppesen PB, Wojdemann M, et al. In vivo and in vitro degradation of glucagon-like peptide-2 in humans. J Clin Endocrinol Metab. 2000;85(8):2884-2888. PMID: 10946898. DOI: 10.1210/jcem.85.8.6717.
  14. Jeppesen PB, Hartmann B, Thulesen J, Graff J, et al. Glucagon-like peptide 2 improves nutrient absorption and nutritional status in short-bowel patients with no colon. Gastroenterology. 2001;120(4):806-815. PMID: 11231933. DOI: 10.1053/gast.2001.22555.
  15. Drucker DJ. The Discovery of GLP-2 and Development of Teduglutide for Short Bowel Syndrome. ACS Pharmacol Transl Sci. 2019;2(2):134-142. PMID: 32219218. DOI: 10.1021/acsptsci.9b00016. (Full text at PMC7088900, read October 4, 2026: Allelix funding; “[hGly2]-GLP-2, later designated teduglutide”; the 1999 merger with NPS; the advisory committee of October 16, 2012; the patent license between Takeda and the University of Toronto, Toronto General Hospital (UHN) and Daniel Drucker.)
  16. Ørskov C, Hartmann B, Poulsen SS, Thulesen J, Hare KJ, Holst JJ. GLP-2 stimulates colonic growth via KGF, released by subepithelial myofibroblasts with GLP-2 receptors. Regul Pept. 2005;124(1-3):105-112. PMID: 15544847. DOI: 10.1016/j.regpep.2004.07.009.
  17. Guan X, Stoll B, Lu X, Tappenden KA, et al. GLP-2-mediated up-regulation of intestinal blood flow and glucose uptake is nitric oxide-dependent in TPN-fed piglets. Gastroenterology. 2003;125(1):136-147. PMID: 12851879.
  18. Drucker DJ, Yusta B, Boushey RP, DeForest L, Brubaker PL. Human [Gly2]GLP-2 reduces the severity of colonic injury in a murine model of experimental colitis. Am J Physiol. 1999;276(1):G79-G91. PMID: 9886982. DOI: 10.1152/ajpgi.1999.276.1.G79.
  19. Boushey RP, Yusta B, Drucker DJ. Glucagon-like peptide (GLP)-2 reduces chemotherapy-associated mortality and enhances cell survival in cells expressing a transfected GLP-2 receptor. Cancer Res. 2001;61(2):687-693. PMID: 11212269.
  20. Thulesen J, Hartmann B, Hare KJ, Kissow H, et al. Glucagon-like peptide 2 (GLP-2) accelerates the growth of colonic neoplasms in mice. Gut. 2004;53(8):1145-1150. PMID: 15247183. DOI: 10.1136/gut.2003.035212.
  21. Naberhuis JK, Deutsch AS, Tappenden KA. Teduglutide-Stimulated Intestinal Adaptation Is Complemented and Synergistically Enhanced by Partial Enteral Nutrition in a Neonatal Piglet Model of Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017;41(5):853-865. PMID: 26304601. DOI: 10.1177/0148607115602891.
  22. Jeppesen PB, Sanguinetti EL, Buchman A, Howard L, et al. Teduglutide (ALX-0600), a dipeptidyl peptidase IV resistant glucagon-like peptide 2 analogue, improves intestinal function in short bowel syndrome patients. Gut. 2005;54(9):1224-1231. PMID: 16099790. DOI: 10.1136/gut.2004.061440.
  23. Jeppesen PB, Gilroy R, Pertkiewicz M, Allard JP, Messing B, O’Keefe SJ. Randomised placebo-controlled trial of teduglutide in reducing parenteral nutrition and/or intravenous fluid requirements in patients with short bowel syndrome. Gut. 2011;60(7):902-914. PMID: 21317170. DOI: 10.1136/gut.2010.218271. (Full text at PMC3112364, read October 5, 2026: the step-down procedure that tested 0.10 mg/kg first; at week 24, parenteral volume fell by 128 mL a day on placebo, and by 2.5 L a week on both doses against 0.9 L on placebo, P = 0.08.)
  24. O’Keefe SJ, Jeppesen PB, Gilroy R, Pertkiewicz M, Allard JP, Messing B. Safety and efficacy of teduglutide after 52 weeks of treatment in patients with short bowel intestinal failure. Clin Gastroenterol Hepatol. 2013;11(7):815-23.e1-3. PMID: 23333663. DOI: 10.1016/j.cgh.2012.12.029.
  25. Jeppesen PB, Pertkiewicz M, Messing B, Iyer K, et al. Teduglutide reduces need for parenteral support among patients with short bowel syndrome with intestinal failure. Gastroenterology. 2012;143(6):1473-1481.e3. PMID: 22982184. DOI: 10.1053/j.gastro.2012.09.007.
  26. Jeppesen PB, Pertkiewicz M, Forbes A, Pironi L, et al. Quality of life in patients with short bowel syndrome treated with the new glucagon-like peptide-2 analogue teduglutide — analyses from a randomised, placebo-controlled study. Clin Nutr. 2013;32(5):713-721. PMID: 23587733. DOI: 10.1016/j.clnu.2013.03.016.
  27. Schwartz LK, O’Keefe SJ, Fujioka K, Gabe SM, et al. Long-Term Teduglutide for the Treatment of Patients With Intestinal Failure Associated With Short Bowel Syndrome. Clin Transl Gastroenterol. 2016;7(2):e142. PMID: 26844839. DOI: 10.1038/ctg.2015.69.
  28. Iyer KR, Kunecki M, Boullata JI, Fujioka K, et al. Independence From Parenteral Nutrition and Intravenous Fluid Support During Treatment With Teduglutide Among Patients With Intestinal Failure Associated With Short Bowel Syndrome. JPEN J Parenter Enteral Nutr. 2017;41(6):946-951. PMID: 27875291. DOI: 10.1177/0148607116680791.
  29. Bioletto F, D’Eusebio C, Merlo FD, Aimasso U, et al. Efficacy of Teduglutide for Parenteral Support Reduction in Patients with Short Bowel Syndrome: A Systematic Review and Meta-Analysis. Nutrients. 2022;14(4):796. PMID: 35215445. DOI: 10.3390/nu14040796.
  30. Tappenden KA, Edelman J, Joelsson B. Teduglutide enhances structural adaptation of the small intestinal mucosa in patients with short bowel syndrome. J Clin Gastroenterol. 2013;47(7):602-607. PMID: 23426461. DOI: 10.1097/MCG.0b013e3182828f57.
  31. Armstrong D, Forbes A, Jeppesen PB, Lee HM, Nagy P, Seidner DL. Colon polyps in patients with short bowel syndrome before and after teduglutide: Post hoc analysis of the STEPS study series. Clin Nutr. 2020;39(6):1774-1777. PMID: 31522784. DOI: 10.1016/j.clnu.2019.08.020.
  32. Carter BA, Cohran VC, Cole CR, Corkins MR, et al. Outcomes from a 12-Week, Open-Label, Multicenter Clinical Trial of Teduglutide in Pediatric Short Bowel Syndrome. J Pediatr. 2017;181:102-111.e5. PMID: 27855998. DOI: 10.1016/j.jpeds.2016.10.027.
  33. Kocoshis SA, Merritt RJ, Hill S, Protheroe S, et al. Safety and Efficacy of Teduglutide in Pediatric Patients With Intestinal Failure due to Short Bowel Syndrome: A 24-Week, Phase III Study. JPEN J Parenter Enteral Nutr. 2020;44(4):621-631. PMID: 31495952. DOI: 10.1002/jpen.1690.
  34. Hill S, Carter BA, Cohran V, Horslen S, et al. Safety Findings in Pediatric Patients During Long-Term Treatment With Teduglutide for Short-Bowel Syndrome-Associated Intestinal Failure: Pooled Analysis of 4 Clinical Studies. JPEN J Parenter Enteral Nutr. 2021;45(7):1456-1465. PMID: 33305440. DOI: 10.1002/jpen.2061.
  35. Marier JF, Beliveau M, Mouksassi MS, Shaw P, et al. Pharmacokinetics, safety, and tolerability of teduglutide, a glucagon-like peptide-2 (GLP-2) analog, following multiple ascending subcutaneous administrations in healthy subjects. J Clin Pharmacol. 2008;48(11):1289-1299. PMID: 18974283. DOI: 10.1177/0091270008320605.
  36. Berg JK, Kim EH, Li B, Joelsson B, Youssef NN. A randomized, double-blind, placebo-controlled, multiple-dose, parallel-group clinical trial to assess the effects of teduglutide on gastric emptying of liquids in healthy subjects. BMC Gastroenterol. 2014;14:25. PMID: 24517114. DOI: 10.1186/1471-230X-14-25.
  37. Iturrino J, Camilleri M, Acosta A, O’Neill J, et al. Acute Effects of a Glucagon-Like Peptide 2 Analogue, Teduglutide, on Gastrointestinal Motor Function and Permeability in Adult Patients With Short Bowel Syndrome on Home Parenteral Nutrition. JPEN J Parenter Enteral Nutr. 2016;40(8):1089-1095. PMID: 26223941. DOI: 10.1177/0148607115597644.
  38. Buchman AL, Katz S, Fang JC, Bernstein CN, Abou-Assi SG; Teduglutide Study Group. Teduglutide, a novel mucosally active analog of glucagon-like peptide-2 (GLP-2) for the treatment of moderate to severe Crohn’s disease. Inflamm Bowel Dis. 2010;16(6):962-973. PMID: 19821509. DOI: 10.1002/ibd.21117.
  39. Chandwe K, Bwakura-Dangarembizi M, Amadi B, Tawodzera G, et al. Malnutrition enteropathy in Zambian and Zimbabwean children with severe acute malnutrition: A multi-arm randomized phase II trial. Nat Commun. 2024;15(1):2910. PMID: 38632262. DOI: 10.1038/s41467-024-45528-0. (Full text at PMC11024201, read October 4, 2026: teduglutide 0.05 mg/kg daily under the skin, from 1.25 mg vials; no adverse events judged related to the study treatments.)
  40. Brehm N, Biavasco F, Clausen J, Jung J, et al. Teduglutide for treatment-refractory severe intestinal acute graft-versus-host disease - a multicenter survey. Bone Marrow Transplant. 2025;60(6):873-878. PMID: 40229535. DOI: 10.1038/s41409-025-02586-2.
  41. Pevny S, Pape UF, Elezkurtaj S, Rieger A, et al. De Novo Development of Distal Jejunal and Duodenal Adenomas After 41 Months of Teduglutide Treatment in a Patient With Short-Bowel Syndrome: A Case Report. JPEN J Parenter Enteral Nutr. 2021;45(3):652-656. PMID: 32740933. DOI: 10.1002/jpen.1982.
  42. Zyczynski LE, McHugh JB, Gribbin TE, Schuetze SM. Alveolar Rhabdomyosarcoma in a 69-Year-Old Woman Receiving Glucagon-Like Peptide-2 Therapy. Case Rep Oncol Med. 2015;2015:107479. PMID: 26266067. DOI: 10.1155/2015/107479.
  43. Wada M, Nakamura S, Hayashi A, Otake R, Miyamoto M, Tanaka T. Six-Month Safety and Effectiveness of Teduglutide in Patients with Short Bowel Syndrome in Japan: Interim Analysis of Post-marketing Surveillance. Adv Ther. 2026;43(1):425-441. PMID: 41324792. DOI: 10.1007/s12325-025-03398-y. (Full text at PMC12858502, read October 4, 2026: approved in Japan since 2021 for patients with a corrected age of 4 months or more and a body weight of 10 kg or more.)
  44. Raghu VK, Binion DG, Smith KJ. Cost-effectiveness of teduglutide in adult patients with short bowel syndrome: Markov modeling using traditional cost-effectiveness criteria. Am J Clin Nutr. 2020;111(1):141-148. PMID: 31665212. DOI: 10.1093/ajcn/nqz269.
  45. ClinicalTrials.gov. Registrations of teduglutide: NCT00072839 (Phase 2 pilot in Crohn’s disease, CL0600-008, ages 18 and older, 100 enrolled, completed 2005), NCT00081458 (Phase 3, CL0600-004, 84 enrolled, completed 2007), NCT00172185 (its extension, 65), NCT00798967 (Phase 3 STEPS, 86, completed 2011), NCT00930644 (STEPS-2, 88), NCT01952080 (pediatric, 12 weeks, 42), NCT02682381 (pediatric Phase 3, 24 weeks, 59), NCT02431325 (Phase 2 in HIV, 32, completed January 2021, results posted), NCT05371028 (retrospective study of Revestive in routine care in Canada, Takeda, 52, completed 2025), NCT04877431 (post-authorization study of Revestive in Argentina, Takeda, 45, completed 2023), NCT06973304 (Phase 3 in Chinese adults, TAK-633, active, not recruiting, 13 enrolled, estimated primary completion February 2027), NCT07537686 (Phase 2 in undernourished women with environmental enteric dysfunction, not yet recruiting, 55 planned, estimated primary completion October 2027), NCT07319832 (observational, Chinese children, recruiting) and NCT01990040 (registry TED-R13-002, observational, 1,806 enrolled, primary outcome colorectal cancer over 10 years, estimated primary completion June 2032). Sponsors: Shire, Takeda, Massachusetts General Hospital, icddr,b. clinicaltrials.gov, API v2. Read October 4, 2026 (NCT05371028 and NCT04877431, October 5, 2026).
  46. FDA. Drugs@FDA: ZORBTIVE (somatropin), BLA 021597, EMD Serono, original approval December 1, 2003 (orphan); and the Zorbtive label (2003): indicated for the treatment of short bowel syndrome in patients receiving specialized nutritional support. accessdata.fda.gov/drugsatfda_docs/label/2003/20604s026_zorbtive_lbl.pdf. Read October 4, 2026.
  47. A laboratory-reagent supplier’s product insert for teduglutide ([Gly2]hGLP-2; ≥98%; supplied as a solid; storage −20 °C; “This product is for research only — not for human or veterinary diagnostic or therapeutic use”). Read October 4, 2026. The supplier is not named: Kalios doesn’t name or link vendors.
  48. Code of Federal Regulations. 21 CFR 216.23, Bulk drug substances that can be used to compound drug products in accordance with section 503A of the Federal Food, Drug, and Cosmetic Act; and 21 CFR 216.24, Drug products withdrawn or removed from the market for reasons of safety or effectiveness. ecfr.gov. Read October 4, 2026.
  49. 21 U.S.C. 353a, Pharmacy compounding (section 503A of the Federal Food, Drug, and Cosmetic Act), subsection (b)(1). law.cornell.edu/uscode/text/21/353a. Read October 5, 2026.
  50. FDA. Bulk Drug Substances Nominated for Use in Compounding Under Section 503A of the Federal Food, Drug, and Cosmetic Act (categories 1–3). Updated May 14, 2026. fda.gov/media/94155/download.
  51. FDA. Bulk Drug Substances Nominated for Use in Compounding Under Section 503B of the Federal Food, Drug, and Cosmetic Act (categories 1–3). Updated March 21, 2025. fda.gov/media/94164/download.
  52. World Anti-Doping Agency. Prohibited List 2026 (in effect January 1, 2026). S0, Non-approved substances; S2.3, Growth factors and growth factor modulators. wada-ama.org.
  53. Global DRO (Global Drug Reference Online), a partnership of Sport Integrity Canada, Swiss Sport Integrity, UK Anti-Doping and the United States Anti-Doping Agency. Teduglutide (ingredient; nation of purchase United States) and Revestive (brand; United Kingdom): not prohibited in competition or out of competition; WADA classification: none. globaldro.com. Searched October 5, 2026.
  54. Searches of October 4, 2026: PubMed, “teduglutide” (386 records), with “short bowel OR intestinal failure” (322), with “randomized controlled trial[pt]” (23), with growth hormone or somatropin (19; no human combination study), with BPC-157, larazotide, KPV, thymosin, TB-500 or insulin-like growth factor (7; no combination study), with liraglutide, semaglutide, exenatide or GLP-1 (22; no combination trial), with tendon, ligament, muscle injury, wound healing, skin or sport (6; no human study of those uses), with HIV (3; no publication of NCT02431325); Europe PMC, “teduglutide AND HIV”; ClinicalTrials.gov, “teduglutide” (50 studies), “teduglutide tendon” (none), “teduglutide healthy” (12, safety and physiology studies); openFDA Drugs@FDA, “teduglutide” (one application, NDA 203441); EMA medicines data (Revestive; Teduglutide Viatris); web searches for FDA warning letters naming teduglutide (none) and for teduglutide sold as a research peptide (laboratory-reagent catalogues only; suppliers not named). October 5, 2026: Global DRO, “Teduglutide” (United States) and “Revestive” (United Kingdom); ClinicalTrials.gov, “teduglutide Crohn” (2 studies); a web search for FDA import alerts naming teduglutide (none); Health Canada’s Drug Product Database, “Revestive” (one product, DIN 02445727).

Checked 5 Oct 2026 |  Profile authored by Kalios Peptides research team